HORDB

General Information

ID: hor006386
Uniprot ID: P06883
Protein name: Glicentin-related polypeptide
Gene name: Gcg
Organism: Rattus norvegicus (Rat)
Family: Glucagon family
Source: Animal
Expression: Glucagon release is stimulated by hypoglycemia and inhibited by hyperglycemia, insulin, and somatostatin. GLP-1 and GLP-2 are induced in response to nutrient ingestion.|Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntom
Disease: NA
Comments: NA
Taxonomy: Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0031769 glucagon receptor binding; GO:0042802 identical protein binding; GO:0048018 receptor ligand activity
GO BP: GO:0006094 gluconeogenesis; GO:0006109 regulation of carbohydrate metabolic process; GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0010737 protein kinase A signaling; GO:0010800 positive regulation of peptidyl-threonine phosphorylation; GO:0014823 response to activity; GO:0019216 regulation of lipid metabolic process; GO:0032099 negative regulation of appetite; GO:0033138 positive regulation of peptidyl-serine phosphorylation; GO:0035774 positive regulation of insulin secretion involved in cellular response to glucose stimulus; GO:0042593 glucose homeostasis; GO:0043066 negative regulation of apoptotic process; GO:0045722 positive regulation of gluconeogenesis; GO:0050796 regulation of insulin secretion; GO:0050896 response to stimulus; GO:0051571 obsolete positive regulation of histone H3-K4 methylation; GO:0070374 positive regulation of ERK1 and ERK2 cascade; GO:0071377 cellular response to glucagon stimulus; GO:0090280 positive regulation of calcium ion import; GO:1900118 negative regulation of execution phase of apoptosis; GO:1903576 response to L-arginine; GO:2001243 negative regulation of intrinsic apoptotic signaling pathway
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm; GO:0005886 plasma membrane

Sequence Information

Sequence: HAPQDTEENARSFPASQTEPLEDPDQINED
Length: 30(21-50)
Propeptide: MKTVYIVAGLFVMLVQGSWQHAPQDTEENARSFPASQTEPLEDPDQINEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIAEELGRRHADGSFSDEMNTILDNLATRDFINWLIQTKITDKK
Signal peptide: MKTVYIVAGLFVMLVQGSWQ
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Activity

Function: [Glucagon]: Plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypogl
Mechanism: NA
Cross BBB: NA
Target: Gcgr, Glp1r
Target Unid: P30082, P32301
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: NA
Structure ID: AF-P06883-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006386_AF2.pdb

hor006386_ESM.pdb

Physical Information

Mass:	389889	Formula:	C140H210N40O58
Absent amino acids:	CGKMVWY	Common amino acids:	E
pI:	3.59	Basic residues:	2
Polar residues:	6	Hydrophobic residues:	6
Hydrophobicity:	-165.33	Boman Index:	-11210
Half-Life:	3.5 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	36
Instability Index:	9827.67	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

Literature

PubMed ID: 6094539
Title: Glucagon gene sequence. Four of six exons encode separate functional domains of rat pre-proglucagon.
PubMed ID: 6548696
Title: Pre-proglucagon messenger ribonucleic acid: nucleotide and encoded amino acid sequences of the rat pancreatic complementary deoxyribonucleic acid.
PubMed ID: 3528148
Title: Prepr
PubMed ID: 7937770
Title:
PubMed ID: 11564680
Title:
PubMed ID: 8721980
Title:
PubMed ID: 1692320
Title:
PubMed ID: 10605628
Title:
PubMed ID: 10322410
Title:
PubMed ID: 12626323
Title:
PubMed ID: 14719035
Title:
PubMed ID: 12554744
Title:
PubMed ID: 22673903
Title: